PDB entry 4dcq

View 4dcq on RCSB PDB site
Description: Crystal Structure of the Fab Fragment of 3B5H10, an Antibody-Specific for Extended Polyglutamine Repeats (orthorhombic form)
Class: immune system
Keywords: Fab fragment, immunoglobulin domain, anti-polyglutamine, polyglutamine repeats, IMMUNE SYSTEM
Deposited on 2012-01-18, released 2012-02-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-08-08, with a file datestamp of 2012-08-03.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.188
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3B5H10 FAB light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4DCQ (0-217)
    Domains in SCOPe 2.06: d4dcqa1, d4dcqa2
  • Chain 'B':
    Compound: 3B5H10 FAB heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4DCQ (0-217)
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dcqA (A:)
    lvltqsssasfslgasakltctlnsqhstytiewyqqqplkppkyvmelkkdgshstgdg
    ipdrfsgsssgadryllisniqpedeaiyicgvgdtikeqfvyvfgggtkvtvlgqpkst
    ptltvfppsseelkenkatlvclisnfspsgvtvawkangtpitqgvdtsnptkkgnkfm
    assflhltsdqwrshqsftcqvthegdtvekslspalr
    

  • Chain 'B':
    No sequence available.