PDB entry 4dbp

View 4dbp on RCSB PDB site
Description: Myosin VI nucleotide-free (MDINSERT2) D179Y crystal structure
Class: motor protein/Calcium binding protein
Keywords: motor protein, motor protein-Calcium binding protein complex
Deposited on 2012-01-16, released 2013-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.165
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-VI
    Species: Sus scrofa [TaxId:9823]
    Gene: MYO6
    Database cross-references and differences (RAF-indexed):
    • Uniprot F1RQI7 (Start-813)
      • engineered mutation (177)
  • Chain 'C':
    Compound: calmodulin
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Cam, CG8472
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dbpc_
  • Heterogens: TBU, EDO, IPA, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4dbpC (C:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltde
    evdemireadidgdgqvnyeefvtmmtsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dbpC (C:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevdemiread
    idgdgqvnyeefvtmmts