Lineage for d4dbpc_ (4dbp C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1994753Family a.39.1.5: Calmodulin-like [47502] (24 protein domains)
    Duplication: made with two pairs of EF-hands
  6. 1994810Protein Calmodulin [47516] (12 species)
  7. 1994875Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [47522] (13 PDB entries)
  8. 1994878Domain d4dbpc_: 4dbp C: [194063]
    automated match to d4clna_
    complexed with ca, edo, ipa, tbu

Details for d4dbpc_

PDB Entry: 4dbp (more details), 2.2 Å

PDB Description: myosin vi nucleotide-free (mdinsert2) d179y crystal structure
PDB Compounds: (C:) calmodulin

SCOPe Domain Sequences for d4dbpc_:

Sequence, based on SEQRES records: (download)

>d4dbpc_ a.39.1.5 (C:) Calmodulin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
idfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevd
emireadidgdgqvnyeefvtmmts

Sequence, based on observed residues (ATOM records): (download)

>d4dbpc_ a.39.1.5 (C:) Calmodulin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
idfpefltmmdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevdemiread
idgdgqvnyeefvtmmts

SCOPe Domain Coordinates for d4dbpc_:

Click to download the PDB-style file with coordinates for d4dbpc_.
(The format of our PDB-style files is described here.)

Timeline for d4dbpc_: