PDB entry 4cy9

View 4cy9 on RCSB PDB site
Description: DpsA14 from Streptomyces coelicolor
Class: iron-binding protein
Keywords: iron-binding protein, ferritin
Deposited on 2014-04-10, released 2014-06-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.15351
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dpsa
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9R408 (1-167)
      • expression tag (0)
    Domains in SCOPe 2.07: d4cy9a1, d4cy9a2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4cy9A (A:)
adltpkytvpgiereaagrligvlrlrlhalndlhltlkhvhwnvvgphfiavhemidpq
vdqvrdmaddvaeriaalggvaqgtpgalvaerkwddysigradaiahlgaldvvytgvv
egmraaveeagkidpatedlligqlrdleqfqwfvrahlesaggalat