PDB entry 4cuf

View 4cuf on RCSB PDB site
Description: Human Notch1 EGF domains 11-13 mutant T466S
Class: transcription
Keywords: transcription, metal-binding, transmembrane, developmental, protein, notch signaling pathway, differentiation, phosphorylation, egf-like domain, regulation, receptor, activator, ank repeat, signalling, glycoprotein, extracellular, egf, jagged, nucleus, membrane
Deposited on 2014-03-18, released 2014-05-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.2573
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurogenic locus notch homolog protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46531 (Start-117)
      • expression tag (118-123)
      • engineered mutation (57)
    Domains in SCOPe 2.07: d4cufa1, d4cufa2, d4cufa3, d4cufa4
  • Heterogens: CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cufA (A:)
    saqdvdecslganpcehagkcintlgsfecqclqgytgprceidvnecvsnpcqndascl
    dqigefqcicmpgyegvhcevntdecasspclhngrcldkinefqcecptgftghlcqvd
    lhhildaqkmvwnhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cufA (A:)
    dvdecslganpcehagkcintlgsfecqclqgytgprceidvnecvsnpcqndascldqi
    gefqcicmpgyegvhcevntdecasspclhngrcldkinefqcecptgftghlcqvdlhh
    i