PDB entry 4cky

View 4cky on RCSB PDB site
Description: Structure of the Mycobacterium tuberculosis Type II Dehydroquinase inhibited by a 3-dehydroquinic acid derivative
Class: lyase
Keywords: bacterial proteins, type 2 dehydroquinase, lyase, inhibitor, shikimis acid pathway, substrate specificity
Deposited on 2014-01-10, released 2015-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ckya_
  • Heterogens: NA, SO4, ND3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4ckyA (A:)
selivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlld
wihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspi
atgvivglgiqgyllalrylaehvgt

    Sequence, based on observed residues (ATOM records): (download) 
    >4ckyA (A:)
livnvingpnlgrlgrgtthdelvaliereaaelglkavvrqsdseaqlldwihqaadaa
epvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivglg
iqgyllalrylaeh