PDB entry 4cix

View 4cix on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis type 2 dehydroquinase in complex with(1R,4R,5R)-1,4,5-trihydroxy-3-((1S)-1-hydroxy-2-phenyl) ethylcyclohex-2-en-1-carboxylic acid
Class: lyase
Keywords: bacterial proteins, lyase, inhibitor, protein binding, shikimis acid pathway, substrate specificity
Deposited on 2013-12-17, released 2014-04-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.15348
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 3-dehydroquinate dehydratase
  Species: Mycobacterium tuberculosis [TaxId:1773]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A4Z6
  Domains in SCOPe 2.07: d4cixa_
• Heterogens: W4N, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4cixA (A:)
  selivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlld
  wihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspi
  atgvivglgiqgyllalrylaehvgt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4cixA (A:)
  livnvingpnlgrlgrgtthdelvaliereaaelglkavvrqsdseaqlldwihqaadaa
  epvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivglg
  iqgyllalrylae