PDB entry 4c25

View 4c25 on RCSB PDB site
Description: L-fuculose 1-phosphate aldolase
Class: lyase
Keywords: lyase, fucose processing
Deposited on 2013-08-16, released 2013-12-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.22617
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-fuculose phosphate aldolase
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97N89 (6-210)
      • expression tag (0-5)
      • expression tag (211)
    Domains in SCOPe 2.03: d4c25a_
  • Heterogens: ZN, NI, 13P, SO4, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4c25A (A:)
gshmassdvkqelikygkklvetdltkgtggnlsvfdrekqlmaitpsgidffeikesdi
vvmdingnvvegerlpssewymhliqyqtrddidaiihahttyatvlaclreplpashym
iavagkdvrvaeyatygtkelavnaakamegrravllanhgilagaqnllnafniveeve
ycakiyclaknfgepvvlpdeemelmaekfkf