SCOPe 2.03: Domain d4c25a_: 4c25 A:

Lineage for d4c25a_ (4c25 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
   3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5

4. Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families)

5. Family c.74.1.0: automated matches [227217] (1 protein)
   not a true family

6. Protein automated matches [226955] (2 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:170187] [229518] (2 PDB entries)

8. Domain d4c25a_: 4c25 A: [229781]
   automated match to d1dzxp_
   complexed with 13p, edo, gol, ni, so4, zn

Details for d4c25a_

PDB Entry: 4c25, 2.03 Å

PDB Description: L-fuculose 1-phosphate aldolase

PDB Compounds: (A:) l-fuculose phosphate aldolase

SCOPe Domain Sequences for d4c25a_:

Sequence; same for both SEQRES and ATOM records:

>d4c25a_ c.74.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
gshmassdvkqelikygkklvetdltkgtggnlsvfdrekqlmaitpsgidffeikesdi
vvmdingnvvegerlpssewymhliqyqtrddidaiihahttyatvlaclreplpashym
iavagkdvrvaeyatygtkelavnaakamegrravllanhgilagaqnllnafniveeve
ycakiyclaknfgepvvlpdeemelmaekfkf

Timeline for d4c25a_:

• d4c25a_ is new in SCOPe 2.03-stable
  
• d4c25a_ appears in SCOPe 2.04
  
• d4c25a_ appears in the current release, SCOPe 2.08, called d4c25a1