SCOPe 2.06: Structural Classification of Proteins

PDB entry 4bsp

View 4bsp on RCSB PDB site
Description: Crystal structure of R-spondin 1 (Fu1Fu2) - Holmium soak
Class: signaling protein
Keywords: signaling protein, adult stem cell, leucine-rich repeat, g-protein coupled receptor, furin domain, wnt signaling, congenital anonychia
Deposited on 2013-06-11, released 2013-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2296
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: r-spondin-1
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q2MKA7
Domains in SCOPe 2.06: d4bspa_
Heterogens: HO, SO4, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4bspA (A:)
gsrisaegsqacakgcelcsevngclkcspklfillerndirqvgvclpscppgyfdarn
pdmnkcikckiehceacfshnfctkckeglylhkgrcypacpegssaangtmecsspaaa
hhhhhh

Sequence, based on observed residues (ATOM records): (download)

>4bspA (A:)
cakgcelcsevngclkcspklfillerndirqvgvclpscppgyfdarnpdmnkcikcki
ehceacfshnfctkckeglylhkgrcyp