PDB entry 4bgc

View 4bgc on RCSB PDB site
Description: T1 domain of the renal potassium channel Kv1.3
Class: transport protein
Keywords: transport protein, ion channel
Deposited on 2013-03-25, released 2013-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.16499
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: potassium voltage-gated channel subfamily a member 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22001 (1-101)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d4bgca1, d4bgca2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bgcA (A:)
    mervvinisglrfetqlktlcqfpetllgdpkrrmryfdplrneyffdrnrpsfdailyy
    yqsggrirrpvnvpidifseeirfyqlgeeamekfredegfl