PDB entry 4amh

View 4amh on RCSB PDB site
Description: Influence of circular permutation on the folding pathway of a PDZ domain
Class: structural protein
Keywords: permutation, protein folding, structural protein
Deposited on 2012-03-10, released 2012-12-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disks large homolog 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12959 (94-End)
      • expression tag (11)
      • engineered mutation (27)
      • engineered mutation (63)
      • linker (91-93)
    Domains in SCOPe 2.04: d4amha_
  • Chain 'B':
    Compound: Disks large homolog 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12959 (94-End)
      • engineered mutation (27)
      • engineered mutation (63)
      • linker (91-93)
    Domains in SCOPe 2.04: d4amhb_
  • Heterogens: TRS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4amhA (A:)
mhhhhhlvprgskglgfsiaggvgnqhwpgdnsiyvtkiieggaahkdgklqigdkllav
nnvaleevtheeavtalkntsdfvylkvakpgsgekimeiklikgp

    Sequence, based on observed residues (ATOM records): (download) 
    >4amhA (A:)
skglgfsiaggvgnqhwpgdnsiyvtkiieggaahkdgklqigdkllavnnvaleevthe
eavtalkntsdfvylkvakpgsgekimeiklikg

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4amhB (B:)
mhhhhhlvprgskglgfsiaggvgnqhwpgdnsiyvtkiieggaahkdgklqigdkllav
nnvaleevtheeavtalkntsdfvylkvakpgsgekimeiklikgp

    Sequence, based on observed residues (ATOM records): (download) 
    >4amhB (B:)
kglgfsiaggvgnqhwpgdnsiyvtkiieggaahkdgklqigdkllavnnvaleevthee
avtalkntsdfvylkvakpgsgekimeiklik