PDB entry 4a4h

View 4a4h on RCSB PDB site
Description: Solution structure of SPF30 Tudor domain in complex with asymmetrically dimethylated arginine
Class: RNA binding protein
Keywords: RNA binding protein
Deposited on 2011-10-12, released 2011-11-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: survival of motor neuron-related-splicing factor 30
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4a4ha_
  • Heterogens: DA2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4a4hA (A:)
    astqpthswkvgdkcmavwsedgqcyeaeieeideengtaaitfagygnaevtpllnlkp
    veeg