PDB entry 4a4f

View 4a4f on RCSB PDB site
Description: Solution structure of SPF30 Tudor domain in complex with symmetrically dimethylated arginine
Class: RNA binding protein
Keywords: RNA binding protein
Deposited on 2011-10-12, released 2011-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: survival of motor neuron-related-splicing factor 30
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75940 (0-63)
  Domains in SCOPe 2.07: d4a4fa_
• Heterogens: 2MR

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4a4fA (A:)
  astqpthswkvgdkcmavwsedgqcyeaeieeideengtaaitfagygnaevtpllnlkp
  veeg