PDB entry 3zte

View 3zte on RCSB PDB site
Description: crystal structure of the trp RNA-binding attenuation protein (trap) from bacillus licheniformis.
Class: RNA-binding protein
Keywords: RNA-binding protein, transcription factors, trinucleotide repeats
Deposited on 2011-07-07, released 2011-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.28401
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ztea_
  • Chain 'B':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zteb_
  • Chain 'C':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ztec_
  • Chain 'D':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zted_
  • Chain 'E':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ztee_
  • Chain 'F':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ztef_
  • Chain 'G':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zteg_
  • Chain 'H':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zteh_
  • Chain 'I':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ztei_
  • Chain 'J':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ztej_
  • Chain 'K':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ztek_
  • Chain 'L':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ztel_
  • Chain 'M':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ztem_
  • Chain 'N':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zten_
  • Chain 'O':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zteo_
  • Chain 'P':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ztep_
  • Chain 'Q':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zteq_
  • Chain 'R':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zter_
  • Chain 'S':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ztes_
  • Chain 'T':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ztet_
  • Chain 'U':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zteu_
  • Chain 'V':
    Compound: tryptophan operon RNA-binding attenuation protein (trap)
    Species: BACILLUS LICHENIFORMIS [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ztev_
  • Heterogens: TRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zteA (A:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteA (A:)
    dfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqtan
    gemkseskk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zteB (B:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteB (B:)
    dfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqtan
    gemkseskk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3zteC (C:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteC (C:)
    dfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqtan
    gemkseskk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3zteD (D:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteD (D:)
    dfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqtan
    gemkseskk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3zteE (E:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteE (E:)
    dfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqtan
    gemkseskk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3zteF (F:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteF (F:)
    dfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqtan
    gemkseskk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3zteG (G:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteG (G:)
    dfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqtan
    gemkseskk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3zteH (H:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteH (H:)
    dfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqtan
    gemkseskk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3zteI (I:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteI (I:)
    dfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqtan
    gemkseskk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3zteJ (J:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteJ (J:)
    ndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqta
    ngemkseskk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3zteK (K:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteK (K:)
    dfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqtan
    gemkseskk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3zteL (L:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteL (L:)
    sndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqt
    angemkseskk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3zteM (M:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteM (M:)
    dfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqtan
    gemkseskk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3zteN (N:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteN (N:)
    dfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqtan
    gemkseskk
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3zteO (O:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteO (O:)
    dfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqtan
    gemkseskk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3zteP (P:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteP (P:)
    dfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqtan
    gemkseskk
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3zteQ (Q:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteQ (Q:)
    dfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqtan
    gemkseskk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3zteR (R:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteR (R:)
    dfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqtan
    gemkseskk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3zteS (S:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteS (S:)
    dfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqtan
    gemkseskk
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3zteT (T:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteT (T:)
    dfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqtan
    gemkseskk
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3zteU (U:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteU (U:)
    ndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqta
    ngemkseskk
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3zteV (V:)
    mnmtnnqsndfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvr
    gealiqtangemkseskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zteV (V:)
    dfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqtan
    gemkseskk