Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.5: TRAP-like [51219] (2 families) shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains |
Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (2 proteins) oligomeric ring consists of 11 single-domain subunits automatically mapped to Pfam PF02081 |
Protein automated matches [191248] (4 species) not a true protein |
Species Bacillus licheniformis [TaxId:1402] [189758] (1 PDB entry) |
Domain d3ztec_: 3zte C: [186545] automated match to d1wapa_ complexed with trp |
PDB Entry: 3zte (more details), 2.41 Å
SCOPe Domain Sequences for d3ztec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ztec_ b.82.5.1 (C:) automated matches {Bacillus licheniformis [TaxId: 1402]} dfvvikavedgvnvigltrgtdtrfhhsekldkgevmicqftehtsaikvrgealiqtan gemkseskk
Timeline for d3ztec_: