PDB entry 3zhp

View 3zhp on RCSB PDB site
Description: Human MST3 (STK24) in complex with MO25beta
Class: cell cycle
Keywords: cell cycle, mo25,
Deposited on 2012-12-24, released 2013-01-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.2284
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcium-binding protein 39-like
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3zhpa_
  • Chain 'B':
    Compound: calcium-binding protein 39-like
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Serine/threonine-protein kinase 24
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6E0 (23-End)
      • expression tag (18-22)
  • Chain 'D':
    Compound: Serine/threonine-protein kinase 24
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zhpA (A:)
    gplgsmlplfskshknpaeivkilkdnlailekqdkktdkaseevskslqamkeilcgtn
    ekeppteavaqlaqelyssgllvtliadlqlidfegkkdvtqifnnilrrqigtrsptve
    yisahphilfmllkgyeapqialrcgimlrecirheplakiilfsnqfrdffkyvelstf
    diasdafatfkdlltrhkvlvadfleqnydtifedyekllqsenyvtkrqslkllgelil
    drhnfaimtkyiskpenlklmmnllrdkspniqfeafhvfkvfvasphktqpiveillkn
    qpklieflssfqkertddeqfadeknylikqirdlkktap
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zhpA (A:)
    aeivkilkdnlailekqdkktdkaseevskslqamkeilcppteavaqlaqelyssgllv
    tliadlqlidfegkkdvtqifnnilrrqigtrsptveyisahphilfmllkgyeapqial
    rcgimlrecirheplakiilfsnqfrdffkyvelstfdiasdafatfkdlltrhkvlvad
    fleqnydtifedyekllqsenyvtkrqslkllgelildrhnfaimtkyiskpenlklmmn
    llrdkspniqfeafhvfkvfvasphktqpiveillknqpklieflssfqkertddeqfad
    eknylikqirdlkkt
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.