SCOPe 2.07: Structural Classification of Proteins

PDB entry 3wwk

View 3wwk on RCSB PDB site
Description: Crystal structure of CLEC-2 in complex with rhodocytin
Class: sugar binding protein
Keywords: C-type lectin fold, Carbohydrate binding, Podoplanin, Rhodocytin, SUGAR BINDING PROTEIN
Deposited on 2014-06-20, released 2014-10-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.98 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Snaclec rhodocytin subunit alpha
Species: Calloselasma rhodostoma [TaxId:8717]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9I841 (Start-135)
Domains in SCOPe 2.07: d3wwka_
Chain 'B':
Compound: Snaclec rhodocytin subunit beta
Species: Calloselasma rhodostoma [TaxId:8717]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9I840 (Start-145)
Domains in SCOPe 2.07: d3wwkb_
Chain 'C':
Compound: C-type lectin domain family 1 member B
Species: Homo sapiens [TaxId:9606]
Gene: CLEC1B, CLEC2, UNQ721/PRO1384
Database cross-references and differences (RAF-indexed):
- Uniprot Q9P126 (Start-127)
Domains in SCOPe 2.07: d3wwkc_
Chain 'D':
Compound: Snaclec rhodocytin subunit alpha
Species: Calloselasma rhodostoma [TaxId:8717]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9I841 (Start-135)
Domains in SCOPe 2.07: d3wwkd_
Chain 'E':
Compound: Snaclec rhodocytin subunit beta
Species: Calloselasma rhodostoma [TaxId:8717]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9I840 (Start-145)
Domains in SCOPe 2.07: d3wwke_
Chain 'F':
Compound: C-type lectin domain family 1 member B
Species: Homo sapiens [TaxId:9606]
Gene: CLEC1B, CLEC2, UNQ721/PRO1384
Database cross-references and differences (RAF-indexed):
- Uniprot Q9P126 (Start-127)
Domains in SCOPe 2.07: d3wwkf_
Chain 'G':
Compound: Snaclec rhodocytin subunit alpha
Species: Calloselasma rhodostoma [TaxId:8717]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9I841 (Start-135)
Domains in SCOPe 2.07: d3wwkg_
Chain 'H':
Compound: Snaclec rhodocytin subunit beta
Species: Calloselasma rhodostoma [TaxId:8717]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9I840 (Start-145)
Domains in SCOPe 2.07: d3wwkh_
Chain 'I':
Compound: C-type lectin domain family 1 member B
Species: Homo sapiens [TaxId:9606]
Gene: CLEC1B, CLEC2, UNQ721/PRO1384
Database cross-references and differences (RAF-indexed):
- Uniprot Q9P126 (Start-127)
Domains in SCOPe 2.07: d3wwki_
Chain 'J':
Compound: Snaclec rhodocytin subunit alpha
Species: Calloselasma rhodostoma [TaxId:8717]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9I841 (Start-135)
Domains in SCOPe 2.07: d3wwkj_
Chain 'K':
Compound: Snaclec rhodocytin subunit beta
Species: Calloselasma rhodostoma [TaxId:8717]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9I840 (Start-145)
Domains in SCOPe 2.07: d3wwkk_
Chain 'L':
Compound: C-type lectin domain family 1 member B
Species: Homo sapiens [TaxId:9606]
Gene: CLEC1B, CLEC2, UNQ721/PRO1384
Database cross-references and differences (RAF-indexed):
- Uniprot Q9P126 (Start-127)
Domains in SCOPe 2.07: d3wwkl_

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3wwkA (A:)
gledcdfgwspydqhcyqafneqktwdeaekfcraqengahlasiesngeadfvswlisq
kdeladedyvwiglraqnkeqqcssewsdgssvsyenlidlhtkkcgalekltgfrkwvn
yyceqmhafvckllpy