Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein automated matches [190329] (10 species) not a true protein |
Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [188489] (10 PDB entries) |
Domain d3wwkj_: 3wwk J: [296138] Other proteins in same PDB: d3wwkc_, d3wwke_, d3wwkf_, d3wwki_, d3wwkl_ automated match to d3wwka_ |
PDB Entry: 3wwk (more details), 2.98 Å
SCOPe Domain Sequences for d3wwkj_:
Sequence, based on SEQRES records: (download)
>d3wwkj_ d.169.1.1 (J:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} ledcdfgwspydqhcyqafneqktwdeaekfcraqengahlasiesngeadfvswlisqk deladedyvwiglraqnkeqqcssewsdgssvsyenlidlhtkkcgalekltgfrkwvny yceqmhafvckllpy
>d3wwkj_ d.169.1.1 (J:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} ledcdfgwspydqhcyqafneqktwdeaekfcraqengahlasiesngeadfvswlisqk dyvwiglraqnkeqqcssewsdgssvsyenllhtkkcgalekltgfrkwvnyyceqmhaf vckllpy
Timeline for d3wwkj_: