PDB entry 3wjg

View 3wjg on RCSB PDB site
Description: Crystal structure of mutant nitrobindin M75L/H76L/Q96C/M148W/H158L (NB10) from Arabidopsis thaliana
Class: transport protein
Keywords: beta-barrel, intracellular transport, hydrophobic ligands, TRANSPORT PROTEIN
Deposited on 2013-10-08, released 2014-04-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.16
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0678 fatty acid-binding protein-like protein At1g79260
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At1g79260, At1g79260.1, YUP8H12R.14
    Database cross-references and differences (RAF-indexed):
    • Uniprot O64527 (Start-173)
      • engineered mutation (82-83)
      • engineered mutation (103)
      • engineered mutation (155)
      • engineered mutation (165)
    Domains in SCOPe 2.06: d3wjga_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3wjgA (A:)
mwshpqfeknqlqqlqnpgesppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirf
shsgkpviaytqktwklesgapllaesgyfrprpdgsievviacstglvevqkgtynvde
qsiklksdlvgnaskvkeisrefelvdgklsyvvrwstttnplqpllkaildkl

    Sequence, based on observed residues (ATOM records): (download) 
    >3wjgA (A:)
ppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirfshsgkpviaytqktwklesga
pllaesgyfrprpdgsievviacstglvevqkgtynvdeqsiklksdlvgnaskvkeisr
efelvdgklsyvvrwstttnplqpllkaildkl