PDB entry 3wcq

View 3wcq on RCSB PDB site
Description: Crystal structure analysis of Cyanidioschyzon melorae ferredoxin D58N mutant
Class: electron transport
Keywords: 2Fe-2S cluster, electron transfer, FNR, ELECTRON TRANSPORT
Deposited on 2013-05-31, released 2013-08-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: 0.152
AEROSPACI score: 1.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Cyanidioschyzon merolae [TaxId:45157]
    Gene: petF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q85FT5 (0-96)
      • engineered mutation (57)
    Domains in SCOPe 2.04: d3wcqa_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wcqA (A:)
    mykiqlvnqkegidvtiqcagdqyildaaeeqgvdlpyscragacstcagklvkgsvnqs
    dqsfldedqiskgfiltcvayptsdcviqthqeealy