PDB entry 3w3d

View 3w3d on RCSB PDB site
Description: Crystal structure of smooth muscle G actin DNase I complex
Class: structural protein
Keywords: smooth muscle actin, actin, DNase I, structural protein, G-actin, ATP Binding
Deposited on 2012-12-20, released 2013-01-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin, gamma-enteric smooth muscle
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63270 (0-373)
      • conflict (358)
  • Chain 'B':
    Compound: Deoxyribonuclease-1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3w3db_
  • Heterogens: ATP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3w3dB (B:)
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss
hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq
wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg
lsnemalaisdhypvevtlt