PDB entry 3w2q

View 3w2q on RCSB PDB site
Description: EGFR kinase domain T790M/L858R mutant with HKI-272
Class: transferase/transferase inhibitor
Keywords: ANTI-ONCOGENE, CELL CYCLE, DISEASE MUTATION, KINASE DOMAIN, RECEPTOR, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-12-03, released 2013-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-21, with a file datestamp of 2013-08-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.177
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (6-End)
      • expression tag (5)
      • engineered mutation (98)
      • engineered mutation (166)
    Domains in SCOPe 2.07: d3w2qa1, d3w2qa2
  • Heterogens: HKI, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w2qA (A:)
    hhhhhhapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w2qA (A:)
    hapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkan
    keildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqylln
    wcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaeekeyhaeggkv
    pikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqp
    pictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpspmddv
    vdadeyl