PDB entry 3vzk

View 3vzk on RCSB PDB site
Description: Crystal structure of the Bacillus circulans endo-beta-(1,4)-xylanase (BcX) N35E mutant
Class: hydrolase
Keywords: xylanase, GH-11 glycoside hydrolase, HYDROLASE
Deposited on 2012-10-14, released 2013-05-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.163
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: endo-1,4-beta-xylanase
  Species: Bacillus circulans [TaxId:1397]
  Gene: xlnA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09850 (0-184)
    • engineered mutation (34)
  Domains in SCOPe 2.02: d3vzka_
• Chain 'B':
  Compound: endo-1,4-beta-xylanase
  Species: Bacillus circulans [TaxId:1397]
  Gene: xlnA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09850 (0-184)
    • engineered mutation (34)
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3vzkA (A:)
  astdywqnwtdgggivnavngsggnysvnwsntgefvvgkgwttgspfrtinynagvwap
  ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
  drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
  nvtvw
  

  
  
• Chain 'B':
  No sequence available.