PDB entry 3vpn

View 3vpn on RCSB PDB site
Description: Crystal structure of human ribonucleotide reductase subunit M2 (hRRM2) mutant
Class: oxidoreductase
Keywords: Metal-binding, OXIDOREDUCTASE
Deposited on 2012-03-05, released 2013-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonucleoside-diphosphate reductase subunit M2
    Species: Homo sapiens [TaxId:9606]
    Gene: RR2, RRM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31350 (1-285)
      • expression tag (0)
      • engineered mutation (41)
    Domains in SCOPe 2.07: d3vpna1, d3vpna2
  • Chain 'B':
    Compound: Ribonucleoside-diphosphate reductase subunit M2
    Species: Homo sapiens [TaxId:9606]
    Gene: RR2, RRM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31350 (1-285)
      • expression tag (0)
      • engineered mutation (41)
    Domains in SCOPe 2.07: d3vpnb1, d3vpnb2
  • Heterogens: FE, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vpnA (A:)
    mgvedepllrenprrfvifpieyhdiwqmykkaeasfwtaedvdlskdiqhweslkpeer
    yfishvlaffaasdgivnenlverfsqevqitearcfygfqiamenihsemysllidtyi
    kdpkereflfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasif
    wlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpseervreiiinavrieqefl
    tealpvkligmnctlmkqyiefvadrlmlelgfskvfrvenpfdfm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vpnB (B:)
    mgvedepllrenprrfvifpieyhdiwqmykkaeasfwtaedvdlskdiqhweslkpeer
    yfishvlaffaasdgivnenlverfsqevqitearcfygfqiamenihsemysllidtyi
    kdpkereflfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasif
    wlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpseervreiiinavrieqefl
    tealpvkligmnctlmkqyiefvadrlmlelgfskvfrvenpfdfm