PDB entry 3vi7
View 3vi7 on RCSB PDB site
Description: Human hematopoietic prostaglandin D synthase inhibitor complex structures
Class: Isomerase/Isomerase Inhibitor
Keywords: sigma class glutathione S transferase(GST), isomerase, glutathione S transferase, Ca binding, GSH binding, Prostaglandin H2 binding, Isomerase-Isomerase Inhibitor complex
Deposited on
2011-09-21, released
2012-04-18
The last revision prior to the SCOPe 2.06 freeze date was dated
2012-04-18, with a file datestamp of
2012-04-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.47
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hematopoietic prostaglandin d synthase
Species: Homo sapiens [TaxId:9606]
Gene: HPGDS, GSTS, PGDS, PTGDS2
Database cross-references and differences (RAF-indexed):
- Uniprot O60760
- engineered mutation (142)
Domains in SCOPe 2.06: d3vi7a1, d3vi7a2 - Chain 'B':
Compound: hematopoietic prostaglandin d synthase
Species: Homo sapiens [TaxId:9606]
Gene: HPGDS, GSTS, PGDS, PTGDS2
Database cross-references and differences (RAF-indexed):
- Uniprot O60760
- engineered mutation (142)
Domains in SCOPe 2.06: d3vi7b1, d3vi7b2 - Chain 'C':
Compound: hematopoietic prostaglandin d synthase
Species: Homo sapiens [TaxId:9606]
Gene: HPGDS, GSTS, PGDS, PTGDS2
Database cross-references and differences (RAF-indexed):
- Uniprot O60760
- engineered mutation (142)
Domains in SCOPe 2.06: d3vi7c1, d3vi7c2 - Chain 'D':
Compound: hematopoietic prostaglandin d synthase
Species: Homo sapiens [TaxId:9606]
Gene: HPGDS, GSTS, PGDS, PTGDS2
Database cross-references and differences (RAF-indexed):
- Uniprot O60760 (0-197)
- engineered mutation (142)
Domains in SCOPe 2.06: d3vi7d1, d3vi7d2 - Heterogens: GSH, CBD, CA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3vi7A (A:)
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
qaipavanwikrrpqtkl
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3vi7B (B:)
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
qaipavanwikrrpqtkl
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>3vi7C (C:)
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
qaipavanwikrrpqtkl
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>3vi7D (D:)
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
qaipavanwikrrpqtkl