PDB entry 3v6m

View 3v6m on RCSB PDB site
Description: Inhibition of caspase-6 activity by single mutation outside the active site
Class: hydrolase
Keywords: caspase domain, hydrolase
Deposited on 2011-12-20, released 2012-03-28
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: 0.217
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Caspase-6
  Species: Homo sapiens [TaxId:9606]
  Gene: CASP6
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55212
    • see remark 999 (234)
• Chain 'B':
  Compound: Caspase-6
  Species: Homo sapiens [TaxId:9606]
  Gene: CASP6
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55212
    • see remark 999 (234)
• Chain 'C':
  Compound: Caspase-6
  Species: Homo sapiens [TaxId:9606]
  Gene: CASP6
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55212
    • see remark 999 (234)
• Chain 'D':
  Compound: Caspase-6
  Species: Homo sapiens [TaxId:9606]
  Gene: CASP6
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55212
    • see remark 999 (234)
• Chain 'F':
  Compound: Caspase-6
  Species: Homo sapiens [TaxId:9606]
  Gene: CASP6
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55212
    • see remark 999 (234)
• Chain 'G':
  Compound: Caspase-6
  Species: Homo sapiens [TaxId:9606]
  Gene: CASP6
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55212
    • see remark 999 (234)
• Chain 'I':
  Compound: Caspase-6
  Species: Homo sapiens [TaxId:9606]
  Gene: CASP6
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55212
    • see remark 999 (234)
• Chain 'J':
  Compound: Caspase-6
  Species: Homo sapiens [TaxId:9606]
  Gene: CASP6
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55212
    • see remark 999 (234)
  Domains in SCOPe 2.02: d3v6mj_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  Sequence, based on SEQRES records: (download)
  

  >3v6mJ (J:)
  mafykremfdpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlg
  fevkcfndlkaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltgl
  fkgdkchslvgkpkifiiqacrgnqhdvpvipldvvdnqtekldtnitevdaasvytlpa
  gadflmcysvaegyyshretvngswyiqdlcemlgkygssleftelltlvnrkveqrrvd
  fckdpsaigkkqvpcfasmltkklhffpksnlehhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3v6mJ (J:)
  fdpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlgfevkcfnd
  lkaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltglfkgdkchs
  lvgkpkifiiqacytlpagadflmcysvtvngswyiqdlcemlgkygssleftelltlvn
  rkveqrrvvpcfasmltkklhffpks