PDB entry 3usn

View 3usn on RCSB PDB site
Description: structure of the catalytic domain of human fibroblast stromelysin-1 inhibited with the thiadiazole inhibitor ipnu-107859, nmr, 1 structure
Deposited on 1998-06-18, released 1999-01-20
The last revision prior to the SCOP 1.61 freeze date was dated 1999-01-20, with a file datestamp of 1999-01-20.
Experiment type: NMR1
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d3usn__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3usn_ (-)
  frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
  misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
  ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp