PDB entry 3uqd

View 3uqd on RCSB PDB site
Description: Crystal structure of the Phosphofructokinase-2 from Escherichia coli in complex with substrates and products
Class: transferase
Keywords: phosphofructokinases, pfk-2, glycolysis, transferase
Deposited on 2011-11-20, released 2012-11-28
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.198
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphofructokinase isozyme 2
    Species: Escherichia coli [TaxId:83333]
    Gene: b1723, JW5280, PFK2, pfkB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3uqda_
  • Chain 'B':
    Compound: 6-phosphofructokinase isozyme 2
    Species: Escherichia coli [TaxId:83333]
    Gene: b1723, JW5280, PFK2, pfkB
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 6-phosphofructokinase isozyme 2
    Species: Escherichia coli [TaxId:83333]
    Gene: b1723, JW5280, PFK2, pfkB
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 6-phosphofructokinase isozyme 2
    Species: Escherichia coli [TaxId:83333]
    Gene: b1723, JW5280, PFK2, pfkB
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ATP, F6P, MG, FBP, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3uqdA (A:)
mvriytltlapsldsatitpqiypegklrctapvfepgggginvaraiahlggsataifp
aggatgehlvslladenvpvatveakdwtrqnlhvhveasgeqyrfvmpgaalnedefrq
leeqvleiesgailvisgslppgvklekltqlisaaqkqgircivdssgealsaalaign
ielvkpnqkelsalvnreltqpddvrkaaqeivnsgkakrvvvslgpqgalgvdsenciq
vvpppvksqstvgagdsmvgamtlklaenasleemvrfgvaagsaatlnqgtrlcshddt
qkiyaylsr

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.