PDB entry 3ub5

View 3ub5 on RCSB PDB site
Description: Profilin:actin with a wide open nucleotide cleft
Class: structural protein
Keywords: ATPase, nucleotide exchange, STRUCTURAL PROTEIN
Deposited on 2011-10-23, released 2012-04-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.219
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin, cytoplasmic 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Profilin-1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3ub5p_
  • Heterogens: ATP, CA, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ub5P (P:)
agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgilvgkdrssffv
ngltlggqkcsvirdsllqdgeftmdlrtkstggaptfnitvtmtaktlvllmgkegvhg
gminkkcyemashlrrsqy