PDB entry 3u5s

View 3u5s on RCSB PDB site
Description: Selenium Substituted Human Augmenter of Liver Regeneration
Class: oxidoreductase
Keywords: Flavin, Liver, OXIDOREDUCTASE, selenium NMR, selenocysteine, selenoproteins, augmenter of liver regeneration
Deposited on 2011-10-11, released 2012-10-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.207
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FAD-linked sulfhydryl oxidase ALR
    Species: Homo sapiens [TaxId:9606]
    Gene: GFER, ALR, HERV1, HPO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55789 (2-125)
      • expression tag (0-1)
      • engineered mutation (74)
      • engineered mutation (85)
    Domains in SCOPe 2.04: d3u5sa_
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3u5sA (A:)
smrtqqkrdtkfredappdreelgrhswavlhtlaayypdlptpeqqqdmaqfihlfskf
ypaeeaaedlrkrlarnhpdtrtraaftqwlahlhnevnrklgkpdfdaskvderwrdgw
kdgsad