PDB entry 3u15

View 3u15 on RCSB PDB site
Description: Structure of hDMX with Dimer Inducing Indolyl Hydantoin RO-2443
Class: protein binding
Keywords: cell cycle, ubiquitin ligase, MDM2, MDMX, p53, PROTEIN BINDING
Deposited on 2011-09-29, released 2012-06-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-08-01, with a file datestamp of 2012-07-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein Mdm4
  Species: Homo sapiens [TaxId:9606]
  Gene: mdm4, mdmx
  Database cross-references and differences (RAF-indexed):
  • Uniprot O15151
• Chain 'B':
  Compound: Protein Mdm4
  Species: Homo sapiens [TaxId:9606]
  Gene: mdm4, mdmx
  Database cross-references and differences (RAF-indexed):
  • Uniprot O15151
• Chain 'C':
  Compound: Protein Mdm4
  Species: Homo sapiens [TaxId:9606]
  Gene: mdm4, mdmx
  Database cross-references and differences (RAF-indexed):
  • Uniprot O15151
  Domains in SCOPe 2.02: d3u15c_
• Chain 'D':
  Compound: Protein Mdm4
  Species: Homo sapiens [TaxId:9606]
  Gene: mdm4, mdmx
  Database cross-references and differences (RAF-indexed):
  • Uniprot O15151
• Heterogens: 03M, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >3u15C (C:)
  gpdsasrispgqinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeq
  hmvycggdllgellgrqsfsvkdpsplydmlrknlvtlat
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3u15C (C:)
  qvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgell
  grqsfsvkdpsplydmlrknlv
  

  
  
• Chain 'D':
  No sequence available.