PDB entry 3ttt

View 3ttt on RCSB PDB site
Description: Structure of F413Y variant of E. coli KatE
Class: oxidoreductase
Keywords: heme orientation, OXIDOREDUCTASE
Deposited on 2011-09-15, released 2011-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.159
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Gene: b1732, JW1721, katE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21179 (Start-752)
      • engineered mutation (412)
    Domains in SCOPe 2.07: d3ttta1, d3ttta2
  • Chain 'B':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Gene: b1732, JW1721, katE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21179 (Start-752)
      • engineered mutation (412)
    Domains in SCOPe 2.07: d3tttb1, d3tttb2
  • Chain 'C':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Gene: b1732, JW1721, katE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21179 (Start-752)
      • engineered mutation (412)
    Domains in SCOPe 2.07: d3tttc1, d3tttc2
  • Chain 'D':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Gene: b1732, JW1721, katE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21179 (Start-752)
      • engineered mutation (412)
    Domains in SCOPe 2.07: d3tttd1, d3tttd2
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tttA (A:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragsrgptlledfilrekithfdhe
    riperivhargsaahgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlysytdtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnglkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tttA (A:)
    slapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgvr
    iaddqnslragsrgptlledfilrekithfdheriperivhargsaahgyfqpykslsdi
    tkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpiff
    iqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsyr
    tmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweaie
    agdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaene
    qaafhpghivpgldftndpllqgrlysytdtqisrlggpnfheipinrptcpyhnfqrdg
    mhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyysh
    prlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgielt
    ddqlnitpppdvnglkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkakg
    vhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylme
    aykhlkpialagdarkfkatikiadqgeegiveadsadgsfmdelltlmaahrvwsripk
    idkipa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tttB (B:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragsrgptlledfilrekithfdhe
    riperivhargsaahgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlysytdtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnglkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tttB (B:)
    slapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgvr
    iaddqnslragsrgptlledfilrekithfdheriperivhargsaahgyfqpykslsdi
    tkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpiff
    iqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsyr
    tmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweaie
    agdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaene
    qaafhpghivpgldftndpllqgrlysytdtqisrlggpnfheipinrptcpyhnfqrdg
    mhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyysh
    prlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgielt
    ddqlnitpppdvnglkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkakg
    vhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylme
    aykhlkpialagdarkfkatikiadqgeegiveadsadgsfmdelltlmaahrvwsripk
    idkipa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tttC (C:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragsrgptlledfilrekithfdhe
    riperivhargsaahgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlysytdtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnglkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tttC (C:)
    slapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgvr
    iaddqnslragsrgptlledfilrekithfdheriperivhargsaahgyfqpykslsdi
    tkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpiff
    iqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsyr
    tmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweaie
    agdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaene
    qaafhpghivpgldftndpllqgrlysytdtqisrlggpnfheipinrptcpyhnfqrdg
    mhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyysh
    prlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgielt
    ddqlnitpppdvnglkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkakg
    vhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylme
    aykhlkpialagdarkfkatikiadqgeegiveadsadgsfmdelltlmaahrvwsripk
    idkipa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tttD (D:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragsrgptlledfilrekithfdhe
    riperivhargsaahgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlysytdtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnglkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tttD (D:)
    slapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgvr
    iaddqnslragsrgptlledfilrekithfdheriperivhargsaahgyfqpykslsdi
    tkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpiff
    iqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsyr
    tmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweaie
    agdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaene
    qaafhpghivpgldftndpllqgrlysytdtqisrlggpnfheipinrptcpyhnfqrdg
    mhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyysh
    prlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgielt
    ddqlnitpppdvnglkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkakg
    vhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylme
    aykhlkpialagdarkfkatikiadqgeegiveadsadgsfmdelltlmaahrvwsripk
    idkipa