Lineage for d3tttc1 (3ttt C:28-597)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570066Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 2570067Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 2570068Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 2570220Protein automated matches [190051] (6 species)
    not a true protein
  7. 2570319Species Escherichia coli [TaxId:562] [233717] (5 PDB entries)
  8. 2570326Domain d3tttc1: 3ttt C:28-597 [233723]
    Other proteins in same PDB: d3ttta2, d3tttb2, d3tttc2, d3tttd2
    automated match to d1cf9a2
    complexed with hem

Details for d3tttc1

PDB Entry: 3ttt (more details), 1.58 Å

PDB Description: Structure of F413Y variant of E. coli KatE
PDB Compounds: (C:) catalase hpii

SCOPe Domain Sequences for d3tttc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tttc1 e.5.1.1 (C:28-597) automated matches {Escherichia coli [TaxId: 562]}
slapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgvr
iaddqnslragsrgptlledfilrekithfdheriperivhargsaahgyfqpykslsdi
tkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpiff
iqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsyr
tmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweaie
agdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaene
qaafhpghivpgldftndpllqgrlysytdtqisrlggpnfheipinrptcpyhnfqrdg
mhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyysh
prlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgielt
ddqlnitpppdvnglkkdpslslyaipdgd

SCOPe Domain Coordinates for d3tttc1:

Click to download the PDB-style file with coordinates for d3tttc1.
(The format of our PDB-style files is described here.)

Timeline for d3tttc1: