PDB entry 3tps

View 3tps on RCSB PDB site
Description: Crystal structure of M-PMV dUTPASE complexed with dUPNPP substrate
Class: hydrolase
Keywords: jelly roll, hydrolase
Deposited on 2011-09-08, released 2011-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotido hydrolase
    Species: Mason-Pfizer monkey virus [TaxId:11855]
    Gene: gag-pro
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tpsa_
  • Heterogens: MG, DUP, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tpsA (A:)
    krvegpapgpetslwgsqlcssqqkqpiskltratpgsagldlcstshtvltpemgpqal
    stgiygplppntfglilgrssitmkglqvypgvidndytgeikimakavnnivtvsqgnr
    iaqlillplietdnkvqqpyrgqgsfgssdiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tpsA (A:)
    kqpiskltratpgsagldlcstshtvltpemgpqalstgiygplppntfglilgrssitm
    kglqvypgvidndytgeikimakavnnivtvsqgnriaqlillplietdnkvq