PDB entry 3to6

View 3to6 on RCSB PDB site
Description: Crystal structure of yeast Esa1 HAT domain complexed with H4K16CoA bisubstrate inhibitor
Class: transferase/transferase inhibitor
Keywords: acetyltransferase, autoacetylation, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-09-04, released 2011-11-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.191
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase ESA1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ESA1, YOR244W, O5257
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3to6a_
  • Chain 'B':
    Compound: histone h4
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CMC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3to6A (A:)
    evarvrnlnriimgkyeiepwyfspypieltdedfiyiddftlqyfgskkqyeryrkkct
    lrhppgneiyrddyvsffeidgrkqrtwcrnlcllsklfldhktlyydvdpflfycmtrr
    delghhlvgyfskekesadgynvaciltlpqyqrmgygklliefsyelskkenkvgspek
    plsdlgllsyraywsdtlitllvehqkeitideissmtsmtttdilhtaktlnilryykg
    qhiiflnedildrynrlkakkrrtidpnrliwkppv
    

  • Chain 'B':
    No sequence available.