PDB entry 3tkb

View 3tkb on RCSB PDB site
Description: crystal structure of human uracil-DNA glycosylase D183G/K302R mutant
Class: hydrolase
Keywords: glycosidase, alpha/beta protein, HYDROLASE
Deposited on 2011-08-26, released 2011-10-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.153
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Gene: UNG, DGU, UNG1, UNG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13051 (3-222)
      • expression tag (0-2)
      • engineered mutation (101)
      • engineered mutation (220)
    Domains in SCOPe 2.02: d3tkba_
  • Heterogens: IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tkbA (A:)
    meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
    lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiegfvhpghgdlsgwakqgvl
    llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
    hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwrel