PDB entry 3tk0

View 3tk0 on RCSB PDB site
Description: mutation of sfALR
Class: flavoprotein
Keywords: Flavin, flavoprotein, sulfhydryl oxidase, FAD, GFER, ALR
Deposited on 2011-08-25, released 2012-08-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.182
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FAD-linked sulfhydryl oxidase ALR
    Species: Homo sapiens [TaxId:9606]
    Gene: GFER, ALR, HERV1, HPO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55789 (1-125)
      • expression tag (0)
      • conflict (62)
      • conflict (74)
      • conflict (85)
    Domains in SCOPe 2.04: d3tk0a_
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3tk0A (A:)
smrtqqkrdtkfredcppdreelgrhswavlhtlaayypdlptpeqqqdmaqfihlfskf
ypseecaedlrkrlarnhpdtrtraaftqwlchlhnevnrklgkpdfdcskvderwrdgw
kdgscd