PDB entry 3tgb

View 3tgb on RCSB PDB site
Description: Crystal structure of L130R mutant of Nitrophorin 4 from Rhodnius prolixus complexed with imidazole at pH 7.4
Class: metal binding protein
Keywords: heme, lipocalin, nitrophorin, METAL BINDING PROTEIN
Deposited on 2011-08-17, released 2012-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.145
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nitrophorin-4
  Species: Rhodnius prolixus [TaxId:13249]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q94734 (0-183)
    • engineered mutation (129)
  Domains in SCOPe 2.07: d3tgba_
• Heterogens: HEM, IMD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3tgbA (A:)
  actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
  dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
  tclhkgnkdrgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
  lltk