PDB entry 3shu

View 3shu on RCSB PDB site
Description: Crystal structure of ZO-1 PDZ3
Class: cell adhesion
Keywords: pdz, cell adhesion
Deposited on 2011-06-17, released 2011-09-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.22
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tight junction protein ZO-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07157 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.04: d3shua_
  • Chain 'B':
    Compound: Tight junction protein ZO-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07157 (3-94)
      • expression tag (0-2)
    Domains in SCOPe 2.04: d3shub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3shuA (A:)
gpgsmklvkfrkgdsvglrlaggndvgifvagvledspaakegleegdqilrvnnvdftn
iireeavlflldlpkgeevtilaqkkkdvyrrive

    Sequence, based on observed residues (ATOM records): (download) 
    >3shuA (A:)
gpgsmklvkfrkgdsvglrlaggndvgifvagvledspaakegleegdqilrvnnvdftn
iireeavlflldlpkgeevtilaqkkkdvyrriv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3shuB (B:)
gpgsmklvkfrkgdsvglrlaggndvgifvagvledspaakegleegdqilrvnnvdftn
iireeavlflldlpkgeevtilaqkkkdvyrrive