PDB entry 3sem

View 3sem on RCSB PDB site
Description: sem5 sh3 domain complexed with peptoid inhibitor
Class: signaling protein/inhibitor
Keywords: sh3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction, signaling protein-inhibitor complex
Deposited on 1998-11-02, released 1999-01-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.248
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sex muscle abnormal protein 5
    Species: Caenorhabditis elegans [TaxId:6239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3sema_
  • Chain 'B':
    Compound: sex muscle abnormal protein 5
    Species: Caenorhabditis elegans [TaxId:6239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3semb_
  • Chain 'C':
    Compound: sh3 peptoid inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 3SEM
  • Chain 'D':
    Compound: sh3 peptoid inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 3SEM (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3semA (A:)
    etkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvcpynsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3semA (A:)
    etkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvcpyn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3semB (B:)
    etkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvcpynsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3semB (B:)
    etkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvcpyn
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.