PDB entry 3sak
View 3sak on RCSB PDB site
Description: high resolution solution nmr structure of the oligomerization domain of p53 by multi-dimensional nmr (sac structures)
Class: apoptosis/cell cycle/gene regulation
Keywords: anti-oncogene, p53 domain, apoptosis/cell cycle/gene regulation complex
Deposited on
1999-04-30, released
1999-06-25
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein (tumor suppressor p53)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d3saka_ - Chain 'B':
Compound: protein (tumor suppressor p53)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d3sakb_ - Chain 'C':
Compound: protein (tumor suppressor p53)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d3sakc_ - Chain 'D':
Compound: protein (tumor suppressor p53)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d3sakd_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3sakA (A:)
kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3sakB (B:)
kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>3sakC (C:)
kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>3sakD (D:)
kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg