PDB entry 3s6w

View 3s6w on RCSB PDB site
Description: Crystal structure of Tudor domain of human TDRD3
Class: transcription
Keywords: Tudor, methylated arginine recognize, iso-propanol, Transcription
Deposited on 2011-05-26, released 2012-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tudor domain-containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: Tdrd3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3s6wa_
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3s6wA (A:)
    mwkpgdecfalywednkfyraevealhssgmtavvkfidygnyeevllsnikpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s6wA (A:)
    mwkpgdecfalywednkfyraevealsgmtavvkfidygnyeevllsnikpi