PDB entry 3s6m

View 3s6m on RCSB PDB site
Description: The structure of a Peptidyl-prolyl cis-trans isomerase from Burkholderia pseudomallei
Class: isomerase
Keywords: Seattle Structural Genomics Center for Infectious Disease, SSGCID, Peptidyl-prolyl cis-trans isomerase, ISOMERASE
Deposited on 2011-05-25, released 2011-06-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-06-08, with a file datestamp of 2011-06-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.148
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_2684
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JQT3 (4-166)
      • expression tag (1-3)
    Domains in SCOPe 2.04: d3s6ma_
  • Heterogens: EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3s6mA (A:)
    gpgsmvelhtnhgvikleldeakapktvenflnyvkkghydgtifhrvingfmiqgggfe
    pglkqkptdapianeannglkndtytiamartndphsataqffinvndneflnhssptpq
    gwgyavfgkvvegqdivdkikavktgskgfhqdvpnddvviekavvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s6mA (A:)
    pgsmvelhtnhgvikleldeakapktvenflnyvkkghydgtifhrvingfmiqgggfep
    glkqkptdapianeannglkndtytiamartndphsataqffinvndneflnhssptpqg
    wgyavfgkvvegqdivdkikavktgshqdvpnddvviekavvv