PDB entry 3rxl

View 3rxl on RCSB PDB site
Description: Crystal structure of Trypsin complexed with (2,5-dimethyl-3-furyl)methanamine
Class: hydrolase/hydrolase inhibitor
Keywords: Trypsin-like serine proteases, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-05-10, released 2011-08-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.163
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3rxla_
  • Heterogens: CA, GOL, DMS, SZ9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rxlA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn