PDB entry 3ric

View 3ric on RCSB PDB site
Description: Crystal Structure of D48V||A47D mutant of Human Glycolipid Transfer Protein complexed with 3-O-sulfo-galactosylceramide containing nervonoyl acyl chain (24:1)
Class: lipid transport
Keywords: GLTP fold, Lipid transport
Deposited on 2011-04-13, released 2012-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycolipid transfer protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GLTP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZD2 (Start-208)
      • engineered mutation (46-47)
    Domains in SCOPe 2.07: d3rica_
  • Heterogens: CIS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ricA (A:)
    mallaehllkplpadkqietgpfleavshlppffdclgspvftpikdvisgnitkikavy
    dtnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh
    pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeecleki
    rlflvnytatidviyemytqmnaelnykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ricA (A:)
    llaehllkplpadkqietgpfleavshlppffdclgspvftpikdvisgnitkikavydt
    npakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpn
    lirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirl
    flvnytatidviyemytqmnaelnykv