Lineage for d3rica_ (3ric A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737813Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
    multihelical; 2 layers or orthogonally packed helices
  4. 2737814Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family) (S)
  5. 2737815Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins)
  6. 2737816Protein Glycolipid transfer protein, GLTP [110006] (2 species)
  7. 2737819Species Human (Homo sapiens) [TaxId:9606] [110007] (20 PDB entries)
    Uniprot Q9NZD2
  8. 2737844Domain d3rica_: 3ric A: [215829]
    automated match to d4ghpa_
    complexed with cis; mutant

Details for d3rica_

PDB Entry: 3ric (more details), 2.1 Å

PDB Description: crystal structure of d48v||a47d mutant of human glycolipid transfer protein complexed with 3-o-sulfo-galactosylceramide containing nervonoyl acyl chain (24:1)
PDB Compounds: (A:) glycolipid transfer protein

SCOPe Domain Sequences for d3rica_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rica_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
llaehllkplpadkqietgpfleavshlppffdclgspvftpikdvisgnitkikavydt
npakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpn
lirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirl
flvnytatidviyemytqmnaelnykv

SCOPe Domain Coordinates for d3rica_:

Click to download the PDB-style file with coordinates for d3rica_.
(The format of our PDB-style files is described here.)

Timeline for d3rica_: