PDB entry 3r0y

View 3r0y on RCSB PDB site
Description: Crystal Structures of Multidrug-resistant HIV-1 Protease in Complex with Mechanism-Based Aspartyl Protease Inhibitors
Class: Hydrolase/Hydrolase Inhibitor
Keywords: Hydrolase, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2011-03-09, released 2012-04-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.2
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Multidrug-resistant clinical isolate 769 HIV-1 Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q000H7 (0-98)
    • conflict (24)
    • conflict (34-35)
    • conflict (45)
  Domains in SCOPe 2.04: d3r0ya_
• Chain 'B':
  Compound: Multidrug-resistant clinical isolate 769 HIV-1 Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q000H7 (0-98)
    • conflict (24)
    • conflict (34-35)
    • conflict (45)
  Domains in SCOPe 2.04: d3r0yb_
• Heterogens: RSZ, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3r0yA (A:)
  pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
  qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3r0yB (B:)
  pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
  qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf