PDB entry 3r0y

View 3r0y on RCSB PDB site
Description: Crystal Structures of Multidrug-resistant HIV-1 Protease in Complex with Mechanism-Based Aspartyl Protease Inhibitors
Class: Hydrolase/Hydrolase Inhibitor
Keywords: Hydrolase, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2011-03-09, released 2012-04-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.2
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Multidrug-resistant clinical isolate 769 HIV-1 Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q000H7 (0-98)
      • conflict (24)
      • conflict (34-35)
      • conflict (45)
    Domains in SCOPe 2.04: d3r0ya_
  • Chain 'B':
    Compound: Multidrug-resistant clinical isolate 769 HIV-1 Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q000H7 (0-98)
      • conflict (24)
      • conflict (34-35)
      • conflict (45)
    Domains in SCOPe 2.04: d3r0yb_
  • Heterogens: RSZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3r0yA (A:)
    pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
    qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3r0yB (B:)
    pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
    qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf