PDB entry 3qls

View 3qls on RCSB PDB site
Description: Candida albicans dihydrofolate reductase complexed with NADPH and 6-methyl-5-[3-methyl-3-(3,4,5-trimethoxyphenyl)but-1-yn-1-yl]pyrimidine-2,4-diamine (UCP115A)
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: Antifungal Agents, Candida albicans, Drug Design, Enzyme Inhibitors, Fungal Proteins, Models, Molecular Structure, Structure-Activity Relationship, Tetrahydrofolate Dehydrogenase, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2011-02-03, released 2011-07-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.171
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein CaJ7.0360
    Species: Candida albicans [TaxId:5476]
    Gene: CaJ7.0360, CaO19.12607, CaO19.5142, DFR1, DHFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5A5E0 (2-191)
      • expression tag (0-1)
    Domains in SCOPe 2.02: d3qlsa_
  • Chain 'B':
    Compound: Putative uncharacterized protein CaJ7.0360
    Species: Candida albicans [TaxId:5476]
    Gene: CaJ7.0360, CaO19.12607, CaO19.5142, DFR1, DHFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5A5E0 (2-191)
      • expression tag (0-1)
    Domains in SCOPe 2.02: d3qlsb_
  • Heterogens: NAP, 55V, GLY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qlsA (A:)
    mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe
    sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne
    linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg
    dftynytlwtrk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qlsB (B:)
    mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe
    sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne
    linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg
    dftynytlwtrk