PDB entry 3qe1
View 3qe1 on RCSB PDB site
Description: Crystal Structure of PDZ domain of sorting nexin 27 (SNX27) fused to the C-terminal residues (ESESKV) of GIRK3
Class: protein binding
Keywords: PDZ domain, PDZ binding, GIRK3 regulation, early endosomes, brain, neurons, PROTEIN BINDING
Deposited on
2011-01-19, released
2011-03-16
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-04-20, with a file datestamp of
2011-04-15.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.161
AEROSPACI score: 0.56
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Sorting nexin-27, G protein-activated inward rectifier potassium channel 3 chimera
Species: Rattus norvegicus [TaxId:10116]
Gene: Mrt1, Kcnj9
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d3qe1a_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3qe1A (A:)
gshggsprvvrivksesgygfnvrgqvseggqlrsingelyaplqhvsavlpggaadrag
vrkgdrilevngvnvegathkqvvdliragekeliltvlsveseskv
Sequence, based on observed residues (ATOM records): (download)
>3qe1A (A:)
sprvvrivksesgygfnvrgqvseggqlrsingelyaplqhvsavlpggaadragvrkgd
rilevngvnvegathkqvvdliragekeliltvlsveseskv